PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013599300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 439aa    MW: 49823.8 Da    PI: 6.4357
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013599300.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-132165348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W+++Ed++l + ++++G+++W+ Ia+ +   ++  qc+ rw++yl
   XP_013599300.1 21 TWSQQEDDILRKQITLHGTDNWAIIASNFS-DKSTRQCRRRWYTYL 65
                     6*****************************.*************97 PP

2Myb_DNA-binding42.31.7e-1372114246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g W++eEd ll +a + +G++ W+ Ia+ +  gRt++ +k+r+ +
   XP_013599300.1  72 GGWSPEEDTLLCEAQRVFGNR-WTEIAKVVS-GRTDNAVKNRFTT 114
                      67*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.331465IPR017930Myb domain
SuperFamilySSF466898.61E-2518112IPR009057Homeodomain-like
SMARTSM007172.3E-121867IPR001005SANT/Myb domain
CDDcd001671.01E-112165No hitNo description
PfamPF139214.9E-142282No hitNo description
Gene3DG3DSA:1.10.10.609.6E-182273IPR009057Homeodomain-like
PROSITE profilePS5129419.53466120IPR017930Myb domain
SMARTSM007171.5E-1370118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-1874119IPR009057Homeodomain-like
CDDcd001671.89E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MEETRKKKKD DSKKKERHIV TWSQQEDDIL RKQITLHGTD NWAIIASNFS DKSTRQCRRR  60
WYTYLNSDFK TGGWSPEEDT LLCEAQRVFG NRWTEIAKVV SGRTDNAVKN RFTTLCKKRA  120
KYEEAMAKDN TLASCNKRML LPDCGISTPP KAESVSPLAK KIRRSDIPGP TVFGGYGDRS  180
HIKVNSGVNQ HSSYGDRSHI KVVNQQIRPP FWVIAHNEEK IQKDSAKESE GEDKEMFLKK  240
DDPKVTSLMQ QAELLSSLAQ KVNTEQSMEN AWKVLQDFFN KSKENDIFRY GLPDIDFQLE  300
EFKDLVEDLR SSNEDSQASW RQPDLHDSPA SSDYSSGSTT MPHSSGDQTQ QPMLLPDNEQ  360
VDLLSTCHEI VPMSVEEEFN SPVQVTPLFR SLAAGIPSPQ FSESERNFVL KTLGVESPCP  420
SATNLSQPPP CKRVLLDSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-232211910107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
149RKKKKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756580.0KM975658.1 Brassica napus MYB transcription factor 88.1 (MYB88.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013706607.10.0PREDICTED: myb-like protein Q
RefseqXP_013599300.10.0PREDICTED: myb-like protein Q
TrEMBLA0A0N7AGH50.0A0A0N7AGH5_BRANA; MYB transcription factor 88.1
TrEMBLA0A0D3DAG50.0A0A0D3DAG5_BRAOL; Uncharacterized protein
STRINGBra024804.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.20.0myb domain protein 88